PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00495g02007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 242aa    MW: 26841.7 Da    PI: 7.2189
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00495g02007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP30.89.8e-1043912373
                       TCP 23 RlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                              R +++ a++  +  d+LG+ ++sk i+WLl + k++i+el+ ++ +++s +
  Niben101Scf00495g02007.1 43 RTPSSSARQTWA--DRLGLSQPSKVIDWLLDATKHEIDELPPLQMPPPSLS 91
                              778888999877..*****************************88887333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-554109IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLIISNAKTK LIMNPSRNNS QANKQEAAGH DHDHDTNKSK ISRTPSSSAR QTWADRLGLS  60
QPSKVIDWLL DATKHEIDEL PPLQMPPPSL SHFFTNTYMR DGPNQELLSL KESNHFDVTT  120
AFGKDKWIAS NDQENQDGTN VGGYVPLFSS QNISSLPAGS HHLYFCPTAK TFSSLVPAPF  180
MSTTNSQLNH FHFLSSSTNS QHVPPNQLAP TLQLISTPVK TTKTNDHTKG INSQDKDDHD  240
NK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016509420.11e-125PREDICTED: transcription factor TCP17-like
TrEMBLM0ZY349e-33M0ZY34_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000104523e-32(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-07TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5